![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
![]() | Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) ![]() common motif contains conserved histidine residue and metal-binding site |
![]() | Family d.4.1.1: HNH-motif [54061] (2 proteins) |
![]() | Protein DNase domain of colicin E7 [54062] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [54063] (8 PDB entries) |
![]() | Domain d2jazb1: 2jaz B:450-576 [145679] Other proteins in same PDB: d2jaza1, d2jazc1 complexed with po4, zn; mutant |
PDB Entry: 2jaz (more details), 2.03 Å
SCOP Domain Sequences for d2jazb1:
Sequence, based on SEQRES records: (download)
>d2jazb1 d.4.1.1 (B:450-576) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]} pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmddisvvtpkrh idihrgk
>d2jazb1 d.4.1.1 (B:450-576) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]} pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekvydmddisvvtpkrhidihrgk
Timeline for d2jazb1: