Lineage for d2j56l_ (2j56 L:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034451Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 3034452Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 3034453Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 3034510Protein automated matches [190303] (3 species)
    not a true protein
  7. 3034511Species Paracoccus denitrificans [TaxId:266] [187112] (6 PDB entries)
  8. 3034512Domain d2j56l_: 2j56 L: [145650]
    Other proteins in same PDB: d2j56a_, d2j56b_, d2j56h_, d2j56j_
    automated match to d1mg2b_
    complexed with cu, gol, na

Details for d2j56l_

PDB Entry: 2j56 (more details), 2.1 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase n-semiquinone in complex with amicyanin.
PDB Compounds: (L:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d2j56l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j56l_ g.21.1.1 (L:) automated matches {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d2j56l_:

Click to download the PDB-style file with coordinates for d2j56l_.
(The format of our PDB-style files is described here.)

Timeline for d2j56l_: