Class g: Small proteins [56992] (100 folds) |
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) |
Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins) automatically mapped to Pfam PF02975 |
Protein automated matches [190303] (3 species) not a true protein |
Species Paracoccus denitrificans [TaxId:266] [187112] (6 PDB entries) |
Domain d2j56l_: 2j56 L: [145650] Other proteins in same PDB: d2j56a_, d2j56b_, d2j56h_, d2j56j_ automated match to d1mg2b_ complexed with cu, gol, na |
PDB Entry: 2j56 (more details), 2.1 Å
SCOPe Domain Sequences for d2j56l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j56l_ g.21.1.1 (L:) automated matches {Paracoccus denitrificans [TaxId: 266]} tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi vgkas
Timeline for d2j56l_: