Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Amicyanin [49505] (2 species) |
Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries) Uniprot P22364 |
Domain d2j56a_: 2j56 A: [138017] Other proteins in same PDB: d2j56h_, d2j56j_, d2j56l_, d2j56m_ automated match to d1aac__ complexed with cu, gol, na |
PDB Entry: 2j56 (more details), 2.1 Å
SCOPe Domain Sequences for d2j56a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j56a_ b.6.1.1 (A:) Amicyanin {Paracoccus denitrificans [TaxId: 266]} dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
Timeline for d2j56a_: