![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) ![]() |
![]() | Family b.69.2.0: automated matches [232760] (1 protein) not a true family |
![]() | Protein automated matches [232762] (1 species) not a true protein |
![]() | Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries) |
![]() | Domain d2j56h_: 2j56 H: [138019] Other proteins in same PDB: d2j56a_, d2j56b_, d2j56l_, d2j56m_ automated match to d3l4od_ complexed with cu, gol, na |
PDB Entry: 2j56 (more details), 2.1 Å
SCOPe Domain Sequences for d2j56h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j56h_ b.69.2.0 (H:) automated matches {Paracoccus denitrificans [TaxId: 318586]} etqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagrv igmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpdap rflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapdt ffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkihq idlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktasr fvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsvn qlghgpqvittadmg
Timeline for d2j56h_: