Lineage for d2io5a1 (2io5 A:1-154)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1524894Superfamily b.1.22: ASF1-like [101546] (1 family) (S)
    contains extra C-terminal strand
    automatically mapped to Pfam PF04729
  5. 1524895Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 1524896Protein Anti-silencing protein 1, ASF1 [101548] (3 species)
  7. 1524915Species Human (Homo sapiens) [TaxId:9606] [158910] (4 PDB entries)
    Uniprot Q6IA08 1-154! Uniprot Q9Y294 1-154! Uniprot Q9Y294 1-156
  8. 1524918Domain d2io5a1: 2io5 A:1-154 [145538]
    Other proteins in same PDB: d2io5b_, d2io5c_

Details for d2io5a1

PDB Entry: 2io5 (more details), 2.7 Å

PDB Description: Crystal structure of the CIA- histone H3-H4 complex
PDB Compounds: (A:) ASF1A protein

SCOPe Domain Sequences for d2io5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io5a1 b.1.22.1 (A:1-154) Anti-silencing protein 1, ASF1 {Human (Homo sapiens) [TaxId: 9606]}
makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv
lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet
elrenppvkpdfsklqrnilasnprvtrfhinwe

SCOPe Domain Coordinates for d2io5a1:

Click to download the PDB-style file with coordinates for d2io5a1.
(The format of our PDB-style files is described here.)

Timeline for d2io5a1: