Lineage for d2io5a1 (2io5 A:1-154)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 789716Superfamily b.1.22: ASF1-like [101546] (1 family) (S)
    contains extra C-terminal strand
  5. 789717Family b.1.22.1: ASF1-like [101547] (1 protein)
  6. 789718Protein Anti-silencing protein 1, ASF1 [101548] (3 species)
  7. 789723Species Human (Homo sapiens) [TaxId:9606] [158910] (4 PDB entries)
    Uniprot Q6IA08 1-154! Uniprot Q9Y294 1-154! Uniprot Q9Y294 1-156
  8. 789726Domain d2io5a1: 2io5 A:1-154 [145538]
    Other proteins in same PDB: d2io5c1

Details for d2io5a1

PDB Entry: 2io5 (more details), 2.7 Å

PDB Description: Crystal structure of the CIA- histone H3-H4 complex
PDB Compounds: (A:) ASF1A protein

SCOP Domain Sequences for d2io5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io5a1 b.1.22.1 (A:1-154) Anti-silencing protein 1, ASF1 {Human (Homo sapiens) [TaxId: 9606]}
makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv
lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet
elrenppvkpdfsklqrnilasnprvtrfhinwe

SCOP Domain Coordinates for d2io5a1:

Click to download the PDB-style file with coordinates for d2io5a1.
(The format of our PDB-style files is described here.)

Timeline for d2io5a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2io5c1