Lineage for d2io5c_ (2io5 C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1482599Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1482912Protein Histone H4 [47125] (7 species)
  7. 1482913Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (38 PDB entries)
  8. 1482961Domain d2io5c_: 2io5 C: [137542]
    Other proteins in same PDB: d2io5a1, d2io5b_
    automated match to d1kx5b_

Details for d2io5c_

PDB Entry: 2io5 (more details), 2.7 Å

PDB Description: Crystal structure of the CIA- histone H3-H4 complex
PDB Compounds: (C:) histone h4

SCOPe Domain Sequences for d2io5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io5c_ a.22.1.1 (C:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygf

SCOPe Domain Coordinates for d2io5c_:

Click to download the PDB-style file with coordinates for d2io5c_.
(The format of our PDB-style files is described here.)

Timeline for d2io5c_: