SCOPe 2.01: Domain d2gjxd2: 2gjx D:23-166

Lineage for d2gjxd2 (2gjx D:23-166)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
   family GH20

6. Protein beta-hexosaminidase A [160560] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160561] (2 PDB entries)
   Uniprot P06865 23-166

8. Domain d2gjxd2: 2gjx D:23-166 [145205]
   Other proteins in same PDB: d2gjxa1, d2gjxb1, d2gjxb2, d2gjxc1, d2gjxc2, d2gjxd1, d2gjxe1, d2gjxf1, d2gjxf2, d2gjxg1, d2gjxg2, d2gjxh1
   automatically matched to 2GJX A:23-166
   complexed with nag, so4

Details for d2gjxd2

PDB Entry: 2gjx, 2.8 Å

PDB Description: crystallographic structure of human beta-hexosaminidase a

PDB Compounds: (D:) Beta-hexosaminidase alpha chain

SCOPe Domain Sequences for d2gjxd2:

Sequence, based on SEQRES records:

>d2gjxd2 d.92.2.1 (D:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgsgswprpy
ltgkrhtleknvlvvsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletf
sqlvwksaegtffinkteiedfpr

Sequence, based on observed residues (ATOM records):

>d2gjxd2 d.92.2.1 (D:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgtleknvlv
vsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletfsqlvwksaegtffi
nkteiedfpr

Timeline for d2gjxd2:

• d2gjxd2 first appeared in SCOP 1.75
  
• d2gjxd2 appears in SCOPe 2.02
  
• d2gjxd2 appears in the current release, SCOPe 2.08