Lineage for d2gjxd2 (2gjx D:23-166)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211973Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1212866Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 1212867Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
    family GH20
  6. 1212874Protein beta-hexosaminidase A [160560] (1 species)
  7. 1212875Species Human (Homo sapiens) [TaxId:9606] [160561] (2 PDB entries)
    Uniprot P06865 23-166
  8. 1212877Domain d2gjxd2: 2gjx D:23-166 [145205]
    Other proteins in same PDB: d2gjxa1, d2gjxb1, d2gjxb2, d2gjxc1, d2gjxc2, d2gjxd1, d2gjxe1, d2gjxf1, d2gjxf2, d2gjxg1, d2gjxg2, d2gjxh1
    automatically matched to 2GJX A:23-166
    complexed with nag, so4

Details for d2gjxd2

PDB Entry: 2gjx (more details), 2.8 Å

PDB Description: crystallographic structure of human beta-hexosaminidase a
PDB Compounds: (D:) Beta-hexosaminidase alpha chain

SCOPe Domain Sequences for d2gjxd2:

Sequence, based on SEQRES records: (download)

>d2gjxd2 d.92.2.1 (D:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgsgswprpy
ltgkrhtleknvlvvsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletf
sqlvwksaegtffinkteiedfpr

Sequence, based on observed residues (ATOM records): (download)

>d2gjxd2 d.92.2.1 (D:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgtleknvlv
vsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletfsqlvwksaegtffi
nkteiedfpr

SCOPe Domain Coordinates for d2gjxd2:

Click to download the PDB-style file with coordinates for d2gjxd2.
(The format of our PDB-style files is described here.)

Timeline for d2gjxd2: