SCOPe 2.01: Domain d2gjxb2: 2gjx B:54-199

Lineage for d2gjxb2 (2gjx B:54-199)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
   family GH20

6. Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries)

8. Domain d2gjxb2: 2gjx B:54-199 [135312]
   Other proteins in same PDB: d2gjxa1, d2gjxa2, d2gjxb1, d2gjxc1, d2gjxd1, d2gjxd2, d2gjxe1, d2gjxe2, d2gjxf1, d2gjxg1, d2gjxh1, d2gjxh2
   automatically matched to d1o7aa2
   complexed with nag, so4

Details for d2gjxb2

PDB Entry: 2gjx, 2.8 Å

PDB Description: crystallographic structure of human beta-hexosaminidase a

PDB Compounds: (B:) beta-hexosaminidase beta chain

SCOPe Domain Sequences for d2gjxb2:

Sequence, based on SEQRES records:

>d2gjxb2 d.92.2.1 (B:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhh
epaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgle
tfsqlvyqdsygtftinestiidspr

Sequence, based on observed residues (ATOM records):

>d2gjxb2 d.92.2.1 (B:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql
lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
tinestiidspr

Timeline for d2gjxb2:

• d2gjxb2 first appeared in SCOP 1.73
  
• d2gjxb2 appears in SCOP 1.75
  
• d2gjxb2 appears in SCOPe 2.02
  
• d2gjxb2 appears in the current release, SCOPe 2.08