SCOPe 2.01: Domain d2ghwb2: 2ghw B:1-117

Lineage for d2ghwb2 (2ghw B:1-117)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)

8. Domain d2ghwb2: 2ghw B:1-117 [145199]
   Other proteins in same PDB: d2ghwa_, d2ghwb1, d2ghwc_, d2ghwd1
   complexed with cl

Details for d2ghwb2

PDB Entry: 2ghw, 2.3 Å

PDB Description: Crystal structure of SARS spike protein receptor binding domain in complex with a neutralizing antibody, 80R

PDB Compounds: (B:) anti-sars scFv antibody, 80R

SCOPe Domain Sequences for d2ghwb2:

Sequence; same for both SEQRES and ATOM records:

>d2ghwb2 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvqsgggvvqpgkslrlscaasgfafssyamhwvrqapgkglewvavisydgsnkyy
adsvkgrftisrdnskntlylqmnslraedtavyycardrsyyldywgqgtlvtvss

Timeline for d2ghwb2:

• d2ghwb2 first appeared in SCOP 1.75
  
• d2ghwb2 appears in SCOPe 2.02
  
• d2ghwb2 appears in the current release, SCOPe 2.08