Lineage for d2d26a1 (2d26 A:23-358)
- Root: SCOPe 2.08
Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) 
Fold e.1: Serpins [56573] (1 superfamily)
contains a cluster of helices and a beta-sandwichSuperfamily e.1.1: Serpins [56574] (2 families) 
Family e.1.1.1: Serpins [56575] (17 proteins)
automatically mapped to Pfam PF00079
Protein Antitrypsin, alpha-1 [56582] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56583] (15 PDB entries) 
Domain d2d26a1: 2d26 A:23-358 [145062]
Other proteins in same PDB: d2d26c1
Details for d2d26a1
PDB Entry: 2d26 (more details), 3.3 Å
PDB Description: active site distortion is sufficient for proteinase inhibit second crystal structure of covalent serpin-proteinase complex
PDB Compounds: (A:) alpha-1-antitrypsinSCOPe Domain Sequences for d2d26a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d26a1 e.1.1.1 (A:23-358) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]}
fnkitpnlaefafslyrqlahqsnstnilfspvsiaaafamlslgakgdthdeileglnf
nlteipeaqihegfqellhtlnqpdsqlqlttgnglflseglklvdkfledvkklyhsea
ftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkd
teeedfhvdqvttvkvpmmkrlgmfniqhskklsswvllmkylgnataifflpdegklqh
lenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvt
eeaplklskavhkavltidekgteaagamfleaipm
SCOPe Domain Coordinates for d2d26a1:
Click to download the PDB-style file with coordinates for d2d26a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2d26a1:
- d2d26a1 first appeared in SCOP 1.75
- d2d26a1 appears in SCOPe 2.07
View in 3D
