PDB entry 2d26

View 2d26 on RCSB PDB site
Description: Active site distortion is sufficient for proteinase inhibit second crystal structure of covalent serpin-proteinase complex
Class: hydrolase/hydrolase inhibitor
Keywords: serpine proteinase, serpin, covalent serpin-proteinase comp protein-protein interactions, hydrolase/hydrolase inhibitor complex
Deposited on 2005-09-03, released 2005-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.251
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-1-antitrypsin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01009 (Start-357)
      • engineered (50)
      • engineered (58)
      • engineered (67)
      • engineered (69)
      • engineered (100)
      • engineered (231)
    Domains in SCOPe 2.07: d2d26a1
  • Chain 'B':
    Compound: alpha-1-antitrypsin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01009
      • engineered (15)
      • engineered (22)
      • engineered (28)
  • Chain 'C':
    Compound: Elastase-1
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d26c1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d26A (A:)
    mdpqgdaaqktdtshhdqdhptfnkitpnlaefafslyrqlahqsnstnilfspvsiaaa
    famlslgakgdthdeileglnfnlteipeaqihegfqellhtlnqpdsqlqlttgnglfl
    seglklvdkfledvkklyhseaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdt
    vfalvnyiffkgkwerpfevkdteeedfhvdqvttvkvpmmkrlgmfniqhskklsswvl
    lmkylgnataifflpdegklqhlenelthdiitkflenedrrsaslhlpklsitgtydlk
    svlgqlgitkvfsngadlsgvteeaplklskavhkavltidekgteaagamfleaipm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d26A (A:)
    fnkitpnlaefafslyrqlahqsnstnilfspvsiaaafamlslgakgdthdeileglnf
    nlteipeaqihegfqellhtlnqpdsqlqlttgnglflseglklvdkfledvkklyhsea
    ftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkd
    teeedfhvdqvttvkvpmmkrlgmfniqhskklsswvllmkylgnataifflpdegklqh
    lenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvt
    eeaplklskavhkavltidekgteaagamfleaipm
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d26C (C:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d26C (C:)
    teaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgehnlnq
    ndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragtilann
    spcyitgwqlaqtlqqaylptvdyaicssssywgstvknsmvcaggcqgdsggplhclvn
    gqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn