Lineage for d2d26c1 (2d26 C:20-245)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056282Protein Elastase [50536] (4 species)
  7. 2056299Species Pig (Sus scrofa) [TaxId:9823] [50538] (118 PDB entries)
  8. 2056418Domain d2d26c1: 2d26 C:20-245 [131156]
    Other proteins in same PDB: d2d26a1
    automatically matched to d1c1ma_

Details for d2d26c1

PDB Entry: 2d26 (more details), 3.3 Å

PDB Description: Active site distortion is sufficient for proteinase inhibit second crystal structure of covalent serpin-proteinase complex
PDB Compounds: (C:) Elastase-1

SCOPe Domain Sequences for d2d26c1:

Sequence, based on SEQRES records: (download)

>d2d26c1 b.47.1.2 (C:20-245) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
teaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgehnlnq
ndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragtilann
spcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgvrsgc
qgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Sequence, based on observed residues (ATOM records): (download)

>d2d26c1 b.47.1.2 (C:20-245) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
teaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgehnlnq
ndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragtilann
spcyitgwqlaqtlqqaylptvdyaicssssywgstvknsmvcaggcqgdsggplhclvn
gqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d2d26c1:

Click to download the PDB-style file with coordinates for d2d26c1.
(The format of our PDB-style files is described here.)

Timeline for d2d26c1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d26a1