Lineage for d2d26a1 (2d26 A:23-358)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 883177Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 883178Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 883179Family e.1.1.1: Serpins [56575] (16 proteins)
  6. 883243Protein Antitrypsin, alpha-1 [56582] (1 species)
  7. 883244Species Human (Homo sapiens) [TaxId:9606] [56583] (15 PDB entries)
  8. 883258Domain d2d26a1: 2d26 A:23-358 [145062]
    Other proteins in same PDB: d2d26c1

Details for d2d26a1

PDB Entry: 2d26 (more details), 3.3 Å

PDB Description: active site distortion is sufficient for proteinase inhibit second crystal structure of covalent serpin-proteinase complex
PDB Compounds: (A:) alpha-1-antitrypsin

SCOP Domain Sequences for d2d26a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d26a1 e.1.1.1 (A:23-358) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]}
fnkitpnlaefafslyrqlahqsnstnilfspvsiaaafamlslgakgdthdeileglnf
nlteipeaqihegfqellhtlnqpdsqlqlttgnglflseglklvdkfledvkklyhsea
ftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkd
teeedfhvdqvttvkvpmmkrlgmfniqhskklsswvllmkylgnataifflpdegklqh
lenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvt
eeaplklskavhkavltidekgteaagamfleaipm

SCOP Domain Coordinates for d2d26a1:

Click to download the PDB-style file with coordinates for d2d26a1.
(The format of our PDB-style files is described here.)

Timeline for d2d26a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d26c1