Lineage for d2awbi1 (2awb I:73-141)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695423Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2695424Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2695425Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2695443Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
    Uniprot P0A7J7 73-141
  8. 2695458Domain d2awbi1: 2awb I:73-141 [144915]
    Other proteins in same PDB: d2awb01, d2awb11, d2awb21, d2awb31, d2awb41, d2awbc1, d2awbc2, d2awbd1, d2awbe1, d2awbf1, d2awbg1, d2awbg2, d2awbh1, d2awbh2, d2awbi2, d2awbj1, d2awbk1, d2awbl1, d2awbm1, d2awbn1, d2awbo1, d2awbp1, d2awbq1, d2awbr1, d2awbs1, d2awbt1, d2awbu1, d2awbv1, d2awbw1, d2awbx1, d2awby1, d2awbz1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2awbi1

PDB Entry: 2awb (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2awbi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awbi1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

SCOPe Domain Coordinates for d2awbi1:

Click to download the PDB-style file with coordinates for d2awbi1.
(The format of our PDB-style files is described here.)

Timeline for d2awbi1: