![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily) alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta; |
![]() | Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) ![]() some topological similarity to ribosomal protein L22 automatically mapped to Pfam PF01196 |
![]() | Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein) |
![]() | Protein Prokaryotic ribosomal protein L17 [64265] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [160270] (27 PDB entries) Uniprot P02416 1-127 |
![]() | Domain d2awbn1: 2awb N:1-127 [144919] Other proteins in same PDB: d2awb01, d2awb11, d2awb21, d2awb31, d2awb41, d2awbc1, d2awbc2, d2awbd1, d2awbe1, d2awbf1, d2awbg1, d2awbg2, d2awbh1, d2awbh2, d2awbi1, d2awbi2, d2awbj1, d2awbk1, d2awbl1, d2awbm1, d2awbo1, d2awbp1, d2awbq1, d2awbr1, d2awbs1, d2awbt1, d2awbu1, d2awbv1, d2awbw1, d2awbx1, d2awby1, d2awbz1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2awb (more details), 3.46 Å
SCOPe Domain Sequences for d2awbn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2awbn1 d.188.1.1 (N:1-127) Prokaryotic ribosomal protein L17 {Escherichia coli [TaxId: 562]} mrhrksgrqlnrnsshrqamfrnmagslvrheiikttlpkakelrrvveplitlaktdsv anrrlafartrdneivaklfnelgprfasraggytrilkcgfragdnapmayielvdrse kaeaaae
Timeline for d2awbn1:
![]() Domains from other chains: (mouse over for more information) d2awb01, d2awb11, d2awb21, d2awb31, d2awb41, d2awbc1, d2awbc2, d2awbd1, d2awbe1, d2awbf1, d2awbg1, d2awbg2, d2awbh1, d2awbh2, d2awbi1, d2awbi2, d2awbj1, d2awbk1, d2awbl1, d2awbm1, d2awbo1, d2awbp1, d2awbq1, d2awbr1, d2awbs1, d2awbt1, d2awbu1, d2awbv1, d2awbw1, d2awbx1, d2awby1, d2awbz1 |