SCOPe 2.05: Domain d2avyr1: 2avy R:19-73

Lineage for d2avyr1 (2avy R:19-73)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
   Uniprot P0A7T7 19-73

8. Domain d2avyr1: 2avy R:19-73 [144859]
   Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avym1, d2avyn1, d2avyo1, d2avyp1, d2avyq1, d2avys1, d2avyt1, d2avyu1
   Representative structure
   protein/RNA complex; complexed with mg
   protein/RNA complex; complexed with mg

Details for d2avyr1

PDB Entry: 2avy, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2avyr1:

Sequence; same for both SEQRES and ATOM records:

>d2avyr1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

Timeline for d2avyr1:

• d2avyr1 first appeared in SCOP 1.75
  
• d2avyr1 appears in SCOPe 2.04
  
• d2avyr1 appears in SCOPe 2.06
  
• d2avyr1 appears in the current release, SCOPe 2.08