Lineage for d2avyb1 (2avy B:8-225)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840244Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 1840245Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 1840246Protein Ribosomal protein S2 [52315] (3 species)
  7. 1840256Species Escherichia coli [TaxId:562] [159491] (26 PDB entries)
    Uniprot P0A7V0 8-225
  8. 1840269Domain d2avyb1: 2avy B:8-225 [144842]
    Other proteins in same PDB: d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avym1, d2avyn1, d2avyo1, d2avyp1, d2avyq1, d2avyr1, d2avys1, d2avyt1, d2avyu1
    Representative structure
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2avyb1

PDB Entry: 2avy (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (B:) 30S ribosomal protein S2

SCOPe Domain Sequences for d2avyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avyb1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]}
mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil
fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk
ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd
tnsdpdgvdfvipgnddairavtlylgavaatvregrs

SCOPe Domain Coordinates for d2avyb1:

Click to download the PDB-style file with coordinates for d2avyb1.
(The format of our PDB-style files is described here.)

Timeline for d2avyb1: