| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) ![]() fold elaborated with additional structures |
| Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
| Protein Ribosomal protein S2 [52315] (3 species) |
| Species Escherichia coli [TaxId:562] [159491] (26 PDB entries) Uniprot P0A7V0 8-225 |
| Domain d2avyb1: 2avy B:8-225 [144842] Other proteins in same PDB: d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyj1, d2avyk1, d2avyl1, d2avym1, d2avyn1, d2avyo1, d2avyp1, d2avyq1, d2avyr1, d2avys1, d2avyt1, d2avyu1 Representative structure protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2avy (more details), 3.46 Å
SCOPe Domain Sequences for d2avyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avyb1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]}
mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil
fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk
ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd
tnsdpdgvdfvipgnddairavtlylgavaatvregrs
Timeline for d2avyb1: