![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) ![]() automatically mapped to Pfam PF00338 |
![]() | Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
![]() | Protein Ribosomal protein S10 [55001] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [160319] (24 PDB entries) Uniprot P0A7R5 5-102 |
![]() | Domain d2avyj1: 2avy J:5-102 [144851] Other proteins in same PDB: d2avyb1, d2avyc1, d2avyc2, d2avyd1, d2avye1, d2avye2, d2avyf1, d2avyg1, d2avyh1, d2avyi1, d2avyk1, d2avyl1, d2avym1, d2avyn1, d2avyo1, d2avyp1, d2avyq1, d2avyr1, d2avys1, d2avyt1, d2avyu1 Representative structure protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2avy (more details), 3.46 Å
SCOPe Domain Sequences for d2avyj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avyj1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]} ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq yeirthlrlvdiveptektvdalmrldlaagvdvqisl
Timeline for d2avyj1: