SCOPe 2.02: Domain d2a9hd1: 2a9h D:23-119

Lineage for d2a9hd1 (2a9h D:23-119)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (12 PDB entries)

8. Domain d2a9hd1: 2a9h D:23-119 [144792]
   Other proteins in same PDB: d2a9he1
   automatically matched to 2A9H A:23-119

Details for d2a9hd1

PDB Entry: 2a9h

PDB Description: nmr structural studies of a potassium channel / charybdotoxin complex

PDB Compounds: (D:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2a9hd1:

Sequence; same for both SEQRES and ATOM records:

>d2a9hd1 f.14.1.1 (D:23-119) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
alhwraagaatvllvivllagsylavlaergapgaalisypdalwwsvetattvgygdly
pvtlwgrcvavvvmvagitsyglvfaavatwfvgreq

Timeline for d2a9hd1:

• d2a9hd1 first appeared in SCOP 1.75
  
• d2a9hd1 appears in SCOPe 2.01
  
• d2a9hd1 appears in SCOPe 2.03
  
• d2a9hd1 appears in the current release, SCOPe 2.08, called d2a9hd_