Lineage for d2a9hc1 (2a9h C:23-119)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237462Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1237463Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 1237464Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1237481Protein Potassium channel protein [56901] (2 species)
  7. 1237522Species Streptomyces lividans [TaxId:1916] [161074] (12 PDB entries)
  8. 1237538Domain d2a9hc1: 2a9h C:23-119 [144791]
    Other proteins in same PDB: d2a9he1
    automatically matched to 2A9H A:23-119

Details for d2a9hc1

PDB Entry: 2a9h (more details)

PDB Description: nmr structural studies of a potassium channel / charybdotoxin complex
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2a9hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9hc1 f.14.1.1 (C:23-119) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
alhwraagaatvllvivllagsylavlaergapgaalisypdalwwsvetattvgygdly
pvtlwgrcvavvvmvagitsyglvfaavatwfvgreq

SCOPe Domain Coordinates for d2a9hc1:

Click to download the PDB-style file with coordinates for d2a9hc1.
(The format of our PDB-style files is described here.)

Timeline for d2a9hc1: