Lineage for d1ynwa1 (1ynw A:18-113)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035613Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 3035695Protein Vitamin D3 receptor, VDR, DNA-binding domain [75686] (1 species)
  7. 3035696Species Human (Homo sapiens) [TaxId:9606] [75687] (4 PDB entries)
  8. 3035703Domain d1ynwa1: 1ynw A:18-113 [144707]
    Other proteins in same PDB: d1ynwb_
    protein/DNA complex; complexed with zn

Details for d1ynwa1

PDB Entry: 1ynw (more details), 3 Å

PDB Description: crystal structure of vitamin d receptor and 9-cis retinoic acid receptor dna-binding domains bound to a dr3 response element
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d1ynwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynwa1 g.39.1.2 (A:18-113) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
rnvpricgvcgdratgfhfnamtcegckgffrrsmkrkalftcaangdcritkdnrracq
acrlkrcvdigmmkefiltdeevqrkremilkrkee

SCOPe Domain Coordinates for d1ynwa1:

Click to download the PDB-style file with coordinates for d1ynwa1.
(The format of our PDB-style files is described here.)

Timeline for d1ynwa1: