PDB entry 1ynw

View 1ynw on RCSB PDB site
Description: Crystal Structure of Vitamin D Receptor and 9-cis Retinoic Acid Receptor DNA-Binding Domains Bound to a DR3 Response Element
Class: transcription/DNA
Keywords: VDR; RXR; Nuclear Receptor; Protein-DNA Complex, TRANSCRIPTION-DNA COMPLEX
Deposited on 2005-01-25, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.232
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11473
      • engineered (45-46)
      • engineered (59)
    Domains in SCOPe 2.07: d1ynwa1
  • Chain 'B':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ynwb_
  • Chain 'C':
    Compound: 5'-d(*TP*TP*AP*GP*GP*TP*CP*AP*CP*GP*AP*AP*GP*GP*TP*CP*AP*A)-3'
  • Chain 'D':
    Compound: 5'-d(*TP*TP*TP*GP*AP*CP*CP*TP*TP*CP*GP*TP*GP*AP*CP*CP*TP*A)-3'
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ynwA (A:)
    fdrnvpricgvcgdratgfhfnamtcegckgffrrsmkrkalftcaangdcritkdnrra
    cqacrlkrcvdigmmkefiltdeevqrkremilkrkeeealkdslrpkls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynwA (A:)
    rnvpricgvcgdratgfhfnamtcegckgffrrsmkrkalftcaangdcritkdnrracq
    acrlkrcvdigmmkefiltdeevqrkremilkrkee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ynwB (B:)
    ftkhicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqy
    cryqkclamgmkreavqeerqrgkdrnenevestssane
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynwB (B:)
    icaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycryq
    kclamgmkreavq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.