![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.2: Nuclear receptor [57721] (13 proteins) duplication: two zinc-binding motifs |
![]() | Protein automated matches [190314] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188623] (6 PDB entries) |
![]() | Domain d1ynwb_: 1ynw B: [123763] Other proteins in same PDB: d1ynwa1 automated match to d1r0nb_ protein/DNA complex; complexed with zn |
PDB Entry: 1ynw (more details), 3 Å
SCOPe Domain Sequences for d1ynwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynwb_ g.39.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} icaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycryq kclamgmkreavq
Timeline for d1ynwb_: