Lineage for d1ynwb_ (1ynw B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2586782Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 2586864Protein automated matches [190314] (3 species)
    not a true protein
  7. 2586868Species Human (Homo sapiens) [TaxId:9606] [188623] (4 PDB entries)
  8. 2586871Domain d1ynwb_: 1ynw B: [123763]
    Other proteins in same PDB: d1ynwa1
    automated match to d1r0nb_
    protein/DNA complex; complexed with zn

Details for d1ynwb_

PDB Entry: 1ynw (more details), 3 Å

PDB Description: Crystal Structure of Vitamin D Receptor and 9-cis Retinoic Acid Receptor DNA-Binding Domains Bound to a DR3 Response Element
PDB Compounds: (B:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1ynwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynwb_ g.39.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
icaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycryq
kclamgmkreavq

SCOPe Domain Coordinates for d1ynwb_:

Click to download the PDB-style file with coordinates for d1ynwb_.
(The format of our PDB-style files is described here.)

Timeline for d1ynwb_: