![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) ![]() |
![]() | Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
![]() | Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species) |
![]() | Species Pseudomonas putida [TaxId:303] [49490] (29 PDB entries) |
![]() | Domain d1ykld_: 1ykl D: [144661] Other proteins in same PDB: d1ykla_, d1yklc_, d1ykle_, d1yklg_, d1ykli_, d1yklk_ automated match to d1ykkb1 complexed with dhb, fe; mutant |
PDB Entry: 1ykl (more details), 2.25 Å
SCOPe Domain Sequences for d1ykld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ykld_ b.3.6.1 (D:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]} paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrcrhkndrylapld pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
Timeline for d1ykld_: