Lineage for d1ykll_ (1ykl L:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 939143Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 939770Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 939771Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 939951Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 939966Species Pseudomonas putida [TaxId:303] [49490] (29 PDB entries)
  8. 940092Domain d1ykll_: 1ykl L: [144665]
    Other proteins in same PDB: d1ykla_, d1yklc_, d1ykle_, d1yklg_, d1ykli_, d1yklk_
    automated match to d1ykkb1
    complexed with dhb, fe; mutant

Details for d1ykll_

PDB Entry: 1ykl (more details), 2.25 Å

PDB Description: protocatechuate 3,4-dioxygenase y408c mutant bound to dhb
PDB Compounds: (L:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d1ykll_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykll_ b.3.6.1 (L:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrcrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc

SCOPe Domain Coordinates for d1ykll_:

Click to download the PDB-style file with coordinates for d1ykll_.
(The format of our PDB-style files is described here.)

Timeline for d1ykll_: