Lineage for d1ykld_ (1ykl D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2365897Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2365898Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2366107Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 2366122Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)
  8. 2366205Domain d1ykld_: 1ykl D: [144661]
    Other proteins in same PDB: d1ykla_, d1yklc_, d1ykle_, d1yklg_, d1ykli_, d1yklk_
    automated match to d1ykkb1
    complexed with dhb, fe; mutant

Details for d1ykld_

PDB Entry: 1ykl (more details), 2.25 Å

PDB Description: Protocatechuate 3,4-Dioxygenase Y408C mutant bound to DHB
PDB Compounds: (D:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d1ykld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykld_ b.3.6.1 (D:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrcrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc

SCOPe Domain Coordinates for d1ykld_:

Click to download the PDB-style file with coordinates for d1ykld_.
(The format of our PDB-style files is described here.)

Timeline for d1ykld_: