![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest |
![]() | Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) ![]() transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds |
![]() | Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (3 proteins) the common fold is elaborated with additional (sub)domains |
![]() | Protein UBA3 [89764] (1 species) a subunit of the heterodimeric E1 enzyme for NEDD8; contains an all-alpha insert subdomain of the FF-like fold (residues 210-288) and an extra C-terminal alpha+beta subdomain (partly disordered) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89765] (12 PDB entries) Uniprot Q8TBC4 33-458 |
![]() | Domain d1y8xb1: 1y8x B:349-440 [144607] Other proteins in same PDB: d1y8xa1, d1y8xa2 C-terminal, E2 binding domain only; (this domain belongs to Pfam PF08825) fragment; missing more than one-third of the common structure and/or sequence has additional subdomain(s) that are not in the common domain |
PDB Entry: 1y8x (more details), 2.4 Å
SCOPe Domain Sequences for d1y8xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} lpqniqfspsaklqevldyltnsaslqmkspaitatlegknrtlymqsvtsieertrpnl sktlkelglvdgqelavadvttpqtvlfklhf
Timeline for d1y8xb1: