SCOPe 2.08: Domain d1y5ic1: 1y5i C:1-225

Lineage for d1y5ic1 (1y5i C:1-225)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.3: Respiratory nitrate reductase 1 gamma chain [103501] (1 family)
   possible link between the two other superfamilies: this subunit corresponds to the gamma subunit of a functionally related Formate dehydrogenase N complex but is structurally closer to the Fumarate reductase subunit FrdC
   automatically mapped to Pfam PF02665

5. Family f.21.3.1: Respiratory nitrate reductase 1 gamma chain [103502] (2 proteins)

6. Protein Respiratory nitrate reductase 1 gamma chain [103503] (1 species)

7. Species Escherichia coli [TaxId:562] [103504] (6 PDB entries)
   Uniprot P11350

8. Domain d1y5ic1: 1y5i C:1-225 [144597]
   Other proteins in same PDB: d1y5ia1, d1y5ia2, d1y5ib_
   complexed with 3ph, 6mo, aga, f3s, hem, md1, sf4; mutant

Details for d1y5ic1

PDB Entry: 1y5i, 1.9 Å

PDB Description: the crystal structure of the narghi mutant nari-k86a

PDB Compounds: (C:) Respiratory nitrate reductase 1 gamma chain

SCOPe Domain Sequences for d1y5ic1:

Sequence, based on SEQRES records:

>d1y5ic1 f.21.3.1 (C:1-225) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltphwmyeawlpievaqkmamfaggasgvlcliggvlllkrrlfsprvra
tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv
afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

Sequence, based on observed residues (ATOM records):

>d1y5ic1 f.21.3.1 (C:1-225) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltlpievaqkmamfaggasgvlcliggvlllkrrlfsprvratttgadil
ilsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgvafifrlhl
vlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

Timeline for d1y5ic1:

• d1y5ic1 first appeared in SCOP 1.75
  
• d1y5ic1 appears in SCOPe 2.07