PDB entry 1y5i

View 1y5i on RCSB PDB site
Description: The crystal structure of the NarGHI mutant NarI-K86A
Class: oxidoreductase
Keywords: nitrate reduction, membrane protein, electron transfer, Q-site, OXIDOREDUCTASE
Deposited on 2004-12-02, released 2005-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Respiratory nitrate reductase 1 alpha chain
    Species: Escherichia coli [TaxId:562]
    Gene: narG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y5ia1, d1y5ia2
  • Chain 'B':
    Compound: Respiratory nitrate reductase 1 beta chain
    Species: Escherichia coli [TaxId:562]
    Gene: narH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y5ib_
  • Chain 'C':
    Compound: Respiratory nitrate reductase 1 gamma chain
    Species: Escherichia coli [TaxId:562]
    Gene: narI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11350 (0-224)
      • modified residue (0)
      • engineered (85)
    Domains in SCOPe 2.08: d1y5ic1
  • Heterogens: MD1, 6MO, SF4, F3S, 3PH, HEM, AGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y5iA (A:)
    skfldrfryfkqkgetfadghgqllntnrdwedgyrqrwqhdkivrsthgvnctgscswk
    iyvknglvtwetqqtdyprtrpdlpnheprgcprgasyswylysanrlkypmmrkrlmkm
    wreakalhsdpveawasiiedadkaksfkqargrggfvrsswqevneliaasnvytikny
    gpdrvagfspipamsmvsyasgarylsliggtclsfydwycdlppaspqtwgeqtdvpes
    adwynssyiiawgsnvpqtrtpdahfftevrykgtktvavtpdyaeiaklcdlwlapkqg
    tdaamalamghvmlrefhldnpsqyftdyvrrytdmpmlvmleerdgyyaagrmlraadl
    vdalgqennpewktvafntngemvapngsigfrwgekgkwnleqrdgktgeetelqlsll
    gsqdeiaevgfpyfggdgtehfnkvelenvllhklpvkrlqladgstalvttvydltlan
    yglerglndvncatsyddvkaytpawaeqitgvsrsqiiriarefadnadkthgrsmiiv
    gaglnhwyhldmnyrglinmlifcgcvgqsgggwahyvgqeklrpqtgwqplafaldwqr
    parhmnstsyfynhssqwryetvtaeellspmadksrytghlidfnvraermgwlpsapq
    lgtnpltiageaekagmnpvdytvkslkegsirfaaeqpengknhprnlfiwrsnllgss
    gkghefmlkyllgtehgiqgkdlgqqggvkpeevdwqdnglegkldlvvtldfrlsstcl
    ysdiilptatwyekddmntsdmhpfihplsaavdpaweaksdweiykaiakkfsevcvgh
    lgketdivtlpiqhdsaaelaqpldvkdwkkgecdlipgktaphimvverdypatyerft
    sigplmekignggkgiawntqsemdllrklnytkaegpakgqpmlntaidaaemiltlap
    etngqvavkawaalseftgrdhthlalnkedekirfrdiqaqprkiissptwsgledehv
    synagytnvhelipwrtlsgrqqlyqdhqwmrdfgesllvyrppidtrsvkevigqksng
    nqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndwievfns
    ngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkpthmigg
    yahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqesvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y5iA (A:)
    skfldrfryfkqkgetfadghgqllntnrdwedgyrqrwqhdkivrsthgvnctgscswk
    iyvknglvtwetqqtdyprtrpdlpnheprgcprgasyswylysanrlkypmmrkrlmkm
    wreakalhsdpveawasiiedadkaksfkqargrggfvrsswqevneliaasnvytikny
    gpdrvagfspipamsmvsyasgarylsliggtclsfydwycdlppaspqtwgeqtdvpes
    adwynssyiiawgsnvpqtrtpdahfftevrykgtktvavtpdyaeiaklcdlwlapkqg
    tdaamalamghvmlrefhldnpsqyftdyvrrytdmpmlvmleerdgyyaagrmlraadl
    vdalgqennpewktvafntngemvapngsigfrwgekgkwnleqrdgktgeetelqlsll
    gsqdeiaevgfpyfggdgtehfnkvelenvllhklpvkrlqladgstalvttvydltlan
    yglerglndvncatsyddvkaytpawaeqitgvsrsqiiriarefadnadkthgrsmiiv
    gaglnhwyhldmnyrglinmlifcgcvgqsgggwahyvgqeklrpqtgwqplafaldwqr
    parhmnstsyfynhssqwryetvtaeellspmadksrytghlidfnvraermgwlpsapq
    lgtnpltiageaekagmnpvdytvkslkegsirfaaeqpengknhprnlfiwrsnllgss
    gkghefmlkyllgtehgiqgkdlgqqggvkpeevdwqdnglegkldlvvtldfrlsstcl
    ysdiilptatwyekddmntsdmhpfihplsaavdpaweaksdweiykaiakkfsevcvgh
    lgketdivtlpiqhdsaaelaqpldvkdwkkgecdlipgktaphimvverdypatyerft
    sigplmekignggkgiawntqsemdllrklnytkaegpakgqpmlntaidaaemiltlap
    etngqvavkawaalseftgrdhthlalnkedekirfrdiqaqprkiissptwsgledehv
    synagytnvhelipwrtlsgrqqlyqdhqwmrdfgesllvyrppidtrsvkevigqksng
    nqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndwievfns
    ngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkpthmigg
    yahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y5iB (B:)
    mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
    kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
    qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
    prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
    sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
    ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
    piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
    vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
    gdgchgsdtkfnlfnsrridaidvtsktephp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y5iB (B:)
    mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
    kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
    qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
    prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
    sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
    ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
    piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
    vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
    gdgchgsdtkfnlfnsrridaidvtskte
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y5iC (C:)
    mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
    gifvghffgmltphwmyeawlpievaqkmamfaggasgvlcliggvlllkrrlfsprvra
    tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv
    afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y5iC (C:)
    mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
    gifvghffgmltlpievaqkmamfaggasgvlcliggvlllkrrlfsprvratttgadil
    ilsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgvafifrlhl
    vlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh