Lineage for d1y5ic1 (1y5i C:1-225)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629948Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2630186Superfamily f.21.3: Respiratory nitrate reductase 1 gamma chain [103501] (1 family) (S)
    possible link between the two other superfamilies: this subunit corresponds to the gamma subunit of a functionally related Formate dehydrogenase N complex but is structurally closer to the Fumarate reductase subunit FrdC
    automatically mapped to Pfam PF02665
  5. 2630187Family f.21.3.1: Respiratory nitrate reductase 1 gamma chain [103502] (2 proteins)
  6. 2630188Protein Respiratory nitrate reductase 1 gamma chain [103503] (1 species)
  7. 2630189Species Escherichia coli [TaxId:562] [103504] (6 PDB entries)
    Uniprot P11350
  8. 2630190Domain d1y5ic1: 1y5i C:1-225 [144597]
    Other proteins in same PDB: d1y5ia1, d1y5ia2, d1y5ib_
    complexed with 3ph, 6mo, aga, f3s, hem, md1, sf4; mutant

Details for d1y5ic1

PDB Entry: 1y5i (more details), 1.9 Å

PDB Description: the crystal structure of the narghi mutant nari-k86a
PDB Compounds: (C:) Respiratory nitrate reductase 1 gamma chain

SCOPe Domain Sequences for d1y5ic1:

Sequence, based on SEQRES records: (download)

>d1y5ic1 f.21.3.1 (C:1-225) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltphwmyeawlpievaqkmamfaggasgvlcliggvlllkrrlfsprvra
tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv
afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

Sequence, based on observed residues (ATOM records): (download)

>d1y5ic1 f.21.3.1 (C:1-225) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltlpievaqkmamfaggasgvlcliggvlllkrrlfsprvratttgadil
ilsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgvafifrlhl
vlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

SCOPe Domain Coordinates for d1y5ic1:

Click to download the PDB-style file with coordinates for d1y5ic1.
(The format of our PDB-style files is described here.)

Timeline for d1y5ic1: