Lineage for d1xwdb1 (1xwd B:3-107)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703391Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1703392Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1703620Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)
  6. 1703621Protein Follicle stimulating hormone, follitropin, beta chain [64562] (1 species)
  7. 1703622Species Human (Homo sapiens) [TaxId:9606] [64563] (3 PDB entries)
  8. 1703623Domain d1xwdb1: 1xwd B:3-107 [144580]
    Other proteins in same PDB: d1xwda_, d1xwdc1, d1xwdd_, d1xwdf_
    complexed with nag, so4

Details for d1xwdb1

PDB Entry: 1xwd (more details), 2.92 Å

PDB Description: crystal structure of human follicle stimulating hormone complexed with its receptor
PDB Compounds: (B:) Follitropin beta chain

SCOPe Domain Sequences for d1xwdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwdb1 g.17.1.4 (B:3-107) Follicle stimulating hormone, follitropin, beta chain {Human (Homo sapiens) [TaxId: 9606]}
celtnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyetvr
vpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfg

SCOPe Domain Coordinates for d1xwdb1:

Click to download the PDB-style file with coordinates for d1xwdb1.
(The format of our PDB-style files is described here.)

Timeline for d1xwdb1: