![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
![]() | Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins) |
![]() | Protein Follicle stimulating hormone, follitropin, beta chain [64562] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64563] (3 PDB entries) |
![]() | Domain d1xwdb1: 1xwd B:3-107 [144580] Other proteins in same PDB: d1xwda_, d1xwdc1, d1xwdd_, d1xwdf_ complexed with nag, so4 |
PDB Entry: 1xwd (more details), 2.92 Å
SCOPe Domain Sequences for d1xwdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwdb1 g.17.1.4 (B:3-107) Follicle stimulating hormone, follitropin, beta chain {Human (Homo sapiens) [TaxId: 9606]} celtnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyetvr vpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfg
Timeline for d1xwdb1: