SCOPe 2.05: Domain d1xwdb1: 1xwd B:3-107

Lineage for d1xwdb1 (1xwd B:3-107)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)

6. Protein Follicle stimulating hormone, follitropin, beta chain [64562] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64563] (3 PDB entries)

8. Domain d1xwdb1: 1xwd B:3-107 [144580]
   Other proteins in same PDB: d1xwda_, d1xwdc1, d1xwdd_, d1xwdf_
   complexed with nag, so4

Details for d1xwdb1

PDB Entry: 1xwd, 2.92 Å

PDB Description: crystal structure of human follicle stimulating hormone complexed with its receptor

PDB Compounds: (B:) Follitropin beta chain

SCOPe Domain Sequences for d1xwdb1:

Sequence; same for both SEQRES and ATOM records:

>d1xwdb1 g.17.1.4 (B:3-107) Follicle stimulating hormone, follitropin, beta chain {Human (Homo sapiens) [TaxId: 9606]}
celtnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyetvr
vpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfg

Timeline for d1xwdb1:

• d1xwdb1 first appeared in SCOP 1.75
  
• d1xwdb1 appears in SCOPe 2.04
  
• d1xwdb1 appears in SCOPe 2.06
  
• d1xwdb1 appears in the current release, SCOPe 2.08