SCOPe 2.05: Domain d1w98b2: 1w98 B:88-227

Lineage for d1w98b2 (1w98 B:88-227)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein G1/S-specific cyclin-E1 [158597] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158598] (1 PDB entry)
   Uniprot P24864 103-242! Uniprot P24864 243-372

8. Domain d1w98b2: 1w98 B:88-227 [144549]
   Other proteins in same PDB: d1w98a_

Details for d1w98b2

PDB Entry: 1w98, 2.15 Å

PDB Description: the structural basis of cdk2 activation by cyclin e

PDB Compounds: (B:) g1/s-specific cyclin e1

SCOPe Domain Sequences for d1w98b2:

Sequence; same for both SEQRES and ATOM records:

>d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]}
splpvlswanreevwkimlnkektylrdqhfleqhpllqpkmrailldwlmevcevyklh
retfylaqdffdrymatqenvvktllqligisslfiaakleeiyppklhqfayvtdgacs
gdeiltmelmimkalkwrls

Timeline for d1w98b2:

• d1w98b2 first appeared in SCOP 1.75
  
• d1w98b2 appears in SCOPe 2.04
  
• d1w98b2 appears in SCOPe 2.06
  
• d1w98b2 appears in the current release, SCOPe 2.08