![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (8 proteins) |
![]() | Protein G1/S-specific cyclin-E1 [158597] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158598] (1 PDB entry) Uniprot P24864 103-242! Uniprot P24864 243-372 |
![]() | Domain d1w98b2: 1w98 B:88-227 [144549] Other proteins in same PDB: d1w98a1 |
PDB Entry: 1w98 (more details), 2.15 Å
SCOP Domain Sequences for d1w98b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]} splpvlswanreevwkimlnkektylrdqhfleqhpllqpkmrailldwlmevcevyklh retfylaqdffdrymatqenvvktllqligisslfiaakleeiyppklhqfayvtdgacs gdeiltmelmimkalkwrls
Timeline for d1w98b2: