| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein G1/S-specific cyclin-E1 [158597] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [158598] (1 PDB entry) Uniprot P24864 103-242! Uniprot P24864 243-372 |
| Domain d1w98b1: 1w98 B:228-357 [144548] Other proteins in same PDB: d1w98a_ |
PDB Entry: 1w98 (more details), 2.15 Å
SCOPe Domain Sequences for d1w98b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w98b1 a.74.1.1 (B:228-357) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]}
pltivswlnvymqvaylndlhevllpqypqqifiqiaelldlcvldvdclefpygilaas
alyhfssselmqkvsgyqwcdiencvkwmvpfamviretgssklkhfrgvadedahniqt
hrdsldlldk
Timeline for d1w98b1: