SCOPe 2.08: Domain d1w98b1: 1w98 B:228-357

Lineage for d1w98b1 (1w98 B:228-357)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein G1/S-specific cyclin-E1 [158597] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158598] (1 PDB entry)
   Uniprot P24864 103-242! Uniprot P24864 243-372

8. Domain d1w98b1: 1w98 B:228-357 [144548]
   Other proteins in same PDB: d1w98a2, d1w98a3

Details for d1w98b1

PDB Entry: 1w98, 2.15 Å

PDB Description: the structural basis of cdk2 activation by cyclin e

PDB Compounds: (B:) g1/s-specific cyclin e1

SCOPe Domain Sequences for d1w98b1:

Sequence; same for both SEQRES and ATOM records:

>d1w98b1 a.74.1.1 (B:228-357) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]}
pltivswlnvymqvaylndlhevllpqypqqifiqiaelldlcvldvdclefpygilaas
alyhfssselmqkvsgyqwcdiencvkwmvpfamviretgssklkhfrgvadedahniqt
hrdsldlldk

Timeline for d1w98b1:

• d1w98b1 first appeared in SCOP 1.75
  
• d1w98b1 appears in SCOPe 2.07