SCOPe 2.08: Domain d1vs6h2: 1vs6 H:1-58

Lineage for d1vs6h2 (1vs6 H:1-58)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (3 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
   automatically mapped to Pfam PF01281

6. Protein Ribosomal protein L9 N-domain [55660] (3 species)

7. Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
   Uniprot P0A7R1 1-58

8. Domain d1vs6h2: 1vs6 H:1-58 [144464]
   Other proteins in same PDB: d1vs601, d1vs611, d1vs621, d1vs631, d1vs641, d1vs6c1, d1vs6c2, d1vs6d1, d1vs6e1, d1vs6f1, d1vs6g1, d1vs6g2, d1vs6h1, d1vs6i1, d1vs6i2, d1vs6j1, d1vs6k1, d1vs6l1, d1vs6m1, d1vs6n1, d1vs6o1, d1vs6p1, d1vs6q1, d1vs6r1, d1vs6s1, d1vs6t1, d1vs6u1, d1vs6v1, d1vs6w1, d1vs6x1, d1vs6y1, d1vs6z1
   complexed with mg
   complexed with mg

Details for d1vs6h2

PDB Entry: 1vs6, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 50s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d1vs6h2:

Sequence; same for both SEQRES and ATOM records:

>d1vs6h2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

Timeline for d1vs6h2:

• d1vs6h2 first appeared in SCOP 1.75
  
• d1vs6h2 appears in SCOPe 2.07