SCOPe 2.08: Domain d1vs6c1: 1vs6 C:125-269

Lineage for d1vs6c1 (1vs6 C:125-269)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)

7. Species Escherichia coli [TaxId:562] [159027] (27 PDB entries)
   Uniprot P60422 125-269

8. Domain d1vs6c1: 1vs6 C:125-269 [144456]
   Other proteins in same PDB: d1vs601, d1vs611, d1vs621, d1vs631, d1vs641, d1vs6c2, d1vs6d1, d1vs6e1, d1vs6f1, d1vs6g1, d1vs6g2, d1vs6h1, d1vs6h2, d1vs6i1, d1vs6i2, d1vs6j1, d1vs6k1, d1vs6l1, d1vs6m1, d1vs6n1, d1vs6o1, d1vs6p1, d1vs6q1, d1vs6r1, d1vs6s1, d1vs6t1, d1vs6u1, d1vs6v1, d1vs6w1, d1vs6x1, d1vs6y1, d1vs6z1
   complexed with mg
   complexed with mg

Details for d1vs6c1

PDB Entry: 1vs6, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 50s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d1vs6c1:

Sequence; same for both SEQRES and ATOM records:

>d1vs6c1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
pgntlpmrnipvgstvhnvemkpgkggqlarsagtyvqivardgayvtlrlrsgemrkve
adcratlgevgnaehmlrvlgkagaarwrgvrptvrgtamnpvdhphgggegrnfgkhpv
tpwgvqtkgkktrsnkrtdkfivrr

Timeline for d1vs6c1:

• d1vs6c1 first appeared in SCOP 1.75
  
• d1vs6c1 appears in SCOPe 2.07