![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) ![]() interrupted alpha-helix automatically mapped to Pfam PF00832 |
![]() | Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein) |
![]() | Protein Ribosomal protein L39e [48664] (1 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries) Uniprot P22452 |
![]() | Domain d1vqo21: 1vqo 2:1-49 [144429] Other proteins in same PDB: d1vqo11, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqog1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 automatically matched to 1VQ4 2:1-49 protein/RNA complex; complexed with cd, cl, k, mg, na, sr |
PDB Entry: 1vqo (more details), 2.2 Å
SCOPe Domain Sequences for d1vqo21:
Sequence, based on SEQRES records: (download)
>d1vqo21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]} gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde
>d1vqo21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]} gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde
Timeline for d1vqo21:
![]() Domains from other chains: (mouse over for more information) d1vqo11, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqog1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 |