![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
![]() | Protein N-terminal domain of ribosomal protein L2 [50299] (5 species) incomplete OB-fold lacking the last strand |
![]() | Species Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries) Uniprot P20276 includes the N-terminal tail |
![]() | Domain d1vqoa2: 1vqo A:1-90 [120362] Other proteins in same PDB: d1vqo11, d1vqo21, d1vqo31, d1vqoa1, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqog1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 automatically matched to d1s72a2 protein/RNA complex; complexed with cd, cl, k, mg, na, sr missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1vqo (more details), 2.2 Å
SCOPe Domain Sequences for d1vqoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqoa2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]} grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef edgdrrlilapegvgvgdelqvgvsaeiap
Timeline for d1vqoa2:
![]() Domains from other chains: (mouse over for more information) d1vqo11, d1vqo21, d1vqo31, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqog1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 |