SCOPe 2.08: Domain d1vqoe2: 1vqo E:80-172

Lineage for d1vqoe2 (1vqo E:80-172)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
   Uniprot P14135

8. Domain d1vqoe2: 1vqo E:80-172 [120367]
   Other proteins in same PDB: d1vqo11, d1vqo21, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqof1, d1vqog1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1
   automatically matched to d1ffk12
   protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqoe2

PDB Entry: 1vqo, 2.2 Å

PDB Description: The structure of CCPMN bound to the large ribosomal subunit haloarcula marismortui

PDB Compounds: (E:) 50S ribosomal protein L6P

SCOPe Domain Sequences for d1vqoe2:

Sequence; same for both SEQRES and ATOM records:

>d1vqoe2 d.141.1.1 (E:80-172) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}
weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie
avgqtaadieqltrindkdvrvfqdgvyitrkp

Timeline for d1vqoe2:

• d1vqoe2 first appeared in SCOP 1.73
  
• d1vqoe2 appears in SCOPe 2.07