Lineage for d1vqkg1 (1vqk G:12-73)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3047153Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 3047154Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 3047155Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 3047156Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 3047157Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 3047164Domain d1vqkg1: 1vqk G:12-73 [144422]
    Other proteins in same PDB: d1vqk11, d1vqk21, d1vqk31, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkq1, d1vqkr1, d1vqks1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqky1, d1vqkz1
    automatically matched to 1VQ4 G:12-73
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqkg1

PDB Entry: 1vqk (more details), 2.3 Å

PDB Description: the structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
PDB Compounds: (G:) Acidic ribosomal protein P0 homolog

SCOPe Domain Sequences for d1vqkg1:

Sequence, based on SEQRES records: (download)

>d1vqkg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1vqkg1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d1vqkg1:

Click to download the PDB-style file with coordinates for d1vqkg1.
(The format of our PDB-style files is described here.)

Timeline for d1vqkg1: