Lineage for d1vqkh1 (1vqk H:1-163)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2945283Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 2945284Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 2945285Protein Ribosomal protein L10e [54688] (2 species)
  7. 2945286Species Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries)
    Uniprot P60617
  8. 2945293Domain d1vqkh1: 1vqk H:1-163 [120253]
    Other proteins in same PDB: d1vqk11, d1vqk21, d1vqk31, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkg1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkq1, d1vqkr1, d1vqks1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqky1, d1vqkz1
    automatically matched to d1s72h_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqkh1

PDB Entry: 1vqk (more details), 2.3 Å

PDB Description: the structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
PDB Compounds: (H:) 50S ribosomal protein L10e

SCOPe Domain Sequences for d1vqkh1:

Sequence, based on SEQRES records: (download)

>d1vqkh1 d.41.4.1 (H:1-163) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki
vgtaarvqageqlftaycnvedaehvkeafrraynkitpscri

Sequence, based on observed residues (ATOM records): (download)

>d1vqkh1 d.41.4.1 (H:1-163) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
qlftaycnvedaehvkeafrraynkitpscri

SCOPe Domain Coordinates for d1vqkh1:

Click to download the PDB-style file with coordinates for d1vqkh1.
(The format of our PDB-style files is described here.)

Timeline for d1vqkh1: