Lineage for d1vqkr1 (1vqk R:1-150)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2948717Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 2948718Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 2948719Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 2948720Protein Ribosomal protein L22 [54845] (5 species)
  7. 2948758Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
    Uniprot P10970
  8. 2948765Domain d1vqkr1: 1vqk R:1-150 [120263]
    Other proteins in same PDB: d1vqk11, d1vqk21, d1vqk31, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkg1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkq1, d1vqks1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqky1, d1vqkz1
    automatically matched to d1ffko_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqkr1

PDB Entry: 1vqk (more details), 2.3 Å

PDB Description: the structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
PDB Compounds: (R:) 50S ribosomal protein L22P

SCOPe Domain Sequences for d1vqkr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqkr1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOPe Domain Coordinates for d1vqkr1:

Click to download the PDB-style file with coordinates for d1vqkr1.
(The format of our PDB-style files is described here.)

Timeline for d1vqkr1: