Lineage for d1vq9g1 (1vq9 G:12-73)

  1. Root: SCOPe 2.05
  2. 1973804Class j: Peptides [58231] (129 folds)
  3. 1975284Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 1975285Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 1975286Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 1975287Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 1975288Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 1975302Domain d1vq9g1: 1vq9 G:12-73 [144420]
    Other proteins in same PDB: d1vq911, d1vq921, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1
    automatically matched to 1VQ4 G:12-73
    protein/RNA complex; complexed with cd, cl, k, mg, na, sps, sr

Details for d1vq9g1

PDB Entry: 1vq9 (more details), 2.4 Å

PDB Description: the structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (G:) Acidic ribosomal protein P0 homolog

SCOPe Domain Sequences for d1vq9g1:

Sequence, based on SEQRES records: (download)

>d1vq9g1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1vq9g1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d1vq9g1:

Click to download the PDB-style file with coordinates for d1vq9g1.
(The format of our PDB-style files is described here.)

Timeline for d1vq9g1: