Lineage for d1vq9y1 (1vq9 Y:95-236)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834563Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 1834621Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 1834622Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 1834623Protein Ribosomal protein L32e [52044] (1 species)
  7. 1834624Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 1834639Domain d1vq9y1: 1vq9 Y:95-236 [120241]
    Other proteins in same PDB: d1vq911, d1vq921, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9g1, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9z1
    automatically matched to d1jj2x_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sps, sr

Details for d1vq9y1

PDB Entry: 1vq9 (more details), 2.4 Å

PDB Description: the structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d1vq9y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq9y1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d1vq9y1:

Click to download the PDB-style file with coordinates for d1vq9y1.
(The format of our PDB-style files is described here.)

Timeline for d1vq9y1: