SCOPe 2.05: Domain d1vq9k1: 1vq9 K:1-132

Lineage for d1vq9k1 (1vq9 K:1-132)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)
   automatically mapped to Pfam PF00238

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
   Uniprot P22450

8. Domain d1vq9k1: 1vq9 K:1-132 [120227]
   Other proteins in same PDB: d1vq911, d1vq921, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9g1, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1
   automatically matched to d1s72k_
   protein/RNA complex; complexed with cd, cl, k, mg, na, sps, sr

Details for d1vq9k1

PDB Entry: 1vq9, 2.4 Å

PDB Description: the structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (K:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d1vq9k1:

Sequence; same for both SEQRES and ATOM records:

>d1vq9k1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

Timeline for d1vq9k1:

• d1vq9k1 first appeared in SCOP 1.73
  
• d1vq9k1 appears in SCOPe 2.04
  
• d1vq9k1 appears in SCOPe 2.06
  
• d1vq9k1 appears in the current release, SCOPe 2.08